PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G270600.1.p
Common NameLOC101786720, SETIT_006354mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 474aa    MW: 51795.4 Da    PI: 5.7608
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G270600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.9e-32267321155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k rlrWt eLHerFveav++L G+ekAtPk +l+lmkv+gLt++hvkSHLQkYRl
  Seita.4G270600.1.p 267 KSRLRWTLELHERFVEAVNKLEGPEKATPKGVLKLMKVEGLTIYHVKSHLQKYRL 321
                         68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.767264324IPR017930Myb domain
SuperFamilySSF466898.24E-17265321IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-30265322IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-24267322IPR006447Myb domain, plants
PfamPF002492.0E-8269320IPR001005SANT/Myb domain
PfamPF143793.9E-22357403IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MSTQSVATGE QIIAPNETVH ACTSTQTSVL QLFDSKSDHR LLIDDTLSST SQSSSIKTEL  60
IRSSSLSRSL SVNLQKRSPE TDPESPLSHI SHPKFSDPIL SNSSTFCTSL FSSSSKNTDP  120
CRQMGTLPFL PHPPKCEQQV SAGQSSSSSL LFAGDTGNAL DEAEHSDDLK DFLNLSGDAS  180
DGSFHGETNA LAFDEQMEFQ FLSEQLGIAI TDNEESPHLD DIYGTPPQLS SLPVSSCSNQ  240
SIQNLGSPVK VQLSSSRSSS VSATTNKSRL RWTLELHERF VEAVNKLEGP EKATPKGVLK  300
LMKVEGLTIY HVKSHLQKYR LAKYLPETKE DEKASSEDKK AQSGSSSSDS SKTKNLQVAE  360
ALRMQMEVQK QLHEQLEVQR QLQLRIEEHA RYLQKILEEQ QKAGNLSLKA PTKAQAVSPE  420
STASKERSET EAGTSSPRPS KNRNLDAHSE CKSPAVSKRT EFQVDPESEV PCS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966348.10.0PREDICTED: uncharacterized protein LOC101786720
TrEMBLK3XWP60.0K3XWP6_SETIT; Uncharacterized protein
STRINGSi006354m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45263769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.22e-67G2-like family protein